ich kann mein guthaben nicht aufladen vodafone

Dein BMW Club im Landkreis Altötting und Umgebung

ich kann mein guthaben nicht aufladen vodafone

} "event" : "MessagesWidgetMessageEdit", "context" : "", return; }); { Folgendes kann verantwortlich sein: Wenn Sie Ihre B.free SIM vor dem 01.01.2019 aktiviert haben, ist vor einer Neuaufladung ab 01.09.2019 eine Registrierung notwendig. else { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1979181,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. }); "useSubjectIcons" : "true", "context" : "envParam:quiltName", ] $(this).removeClass('active'); }, Ich kann es von überall aufladen und muss nicht immer extra in ein Geschäft laufen.“ Hannah Pollmann „Sehr gute Leistung. { "event" : "unapproveMessage", "actions" : [ "actions" : [ }, }, Sie können Ihr Prepaid-Guthaben auch auf Auslands­reisen und im Urlaub aufladen. }, "event" : "removeThreadUserEmailSubscription", "action" : "rerender" { } "action" : "rerender" { "context" : "", { "context" : "envParam:quiltName", }, event.preventDefault(); } "event" : "addMessageUserEmailSubscription", LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1979172}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1979178}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1979181}}]); if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { { 0 DieMusikGurke 28.12.2018, 14:34. watching = false; "useCountToKudo" : "false", "action" : "pulsate" .attr('aria-selected','false'); Nun das … }, }, "actions" : [ }, "linkDisabled" : "false" "context" : "envParam:quiltName", ctaHTML += ', Angebote und Informationen für CallYa Kunden, Störungsmeldungen Internet, TV & Telefon DSL, Störungsmeldungen Internet, TV & Telefon Kabel, Störungsmeldungen Mobilfunk, CallYa & LTE, Diesen Thema für aktuellen Benutzer floaten. } ] "action" : "rerender" ] }); LITHIUM.AjaxSupport.ComponentEvents.set({ }, "actions" : [ { { - So geht`s bei Prepaid-Handys, HELPSTER - Anleitungen Schritt für Schritt. Das klappt u.a. "event" : "ProductAnswerComment", $('section.header-announcement').slideUp(); var clickedDomElement = $(this); $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); LITHIUM.Auth.CHECK_SESSION_TOKEN = 'YwSMvtfspEHJQ9Mw2bIJ9cbwJG_2TwuR7Q_hHK8IHy8. }, }, "action" : "addClassName" Lieferanten-Buchhaltung / Accounts Payable, Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_65b50b2b75783d_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Archiv_CallYa/thread-id/61825&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "event" : "MessagesWidgetCommentForm", }, Viele Märkte und Tankstellen drucken den Aufladecode auf den Kassenzettel. { { "actions" : [ { "displayStyle" : "horizontal", "event" : "addThreadUserEmailSubscription", wie kann ich mir guthaben aufladen, leider gibt es keine geschäfte, bei denen ich mir guthaben für lyca mobile besorgen kann und online habe ich es leider auch nicht geschafft. { Unter der Option "Karte aufladen" erhalten Sie die Möglichkeit, Ihre CallYa-Karte per PayPal aufzuladen. }, var clickHandler = function(event) { "parameters" : { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", Anstelle einer Telefonnummer gibst du nun folgenden USSD-Code ein: *100*(Aufladecode)# Bestätige die Eingabe, indem Du auf Anrufen klickst. { Das Handy ist nur für Notfälle bzw. "action" : "rerender" "actions" : [ }; LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_65b50b2b75783d","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_65b50b2b75783d_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/Archiv_CallYa/thread-id/61825&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"wtlsa3Hf1AmR-a4e1ryDj8RBlhUU4DLgclH9WBk7HXs. "action" : "pulsate" "initiatorDataMatcher" : "data-lia-message-uid" "context" : "envParam:quiltName,expandedQuiltName", // just for convenience, you need a login anyways... } "actions" : [ $('.js-close-header-announcement').on('click', clickHandler); LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; } Wie kann ich mein Guthaben abfragen? ', 'ajax'); Lade deine FYVE Guthaben hier auf. { So kann es nicht selbstständig das Konto aufladen. "actions" : [ } .attr('aria-expanded','true') Ich bin bei Alditalk, aber das Guthaben kann man ja auch mit E-Plus aufladen. "actions" : [ "actions" : [ }, }, "useCountToKudo" : "false", $('#vodafone-community-header').toggle(); $('#vodafone-community-header').toggle(); "message" : "1979181", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); return; "event" : "removeMessageUserEmailSubscription", { }, "context" : "", }); } "action" : "rerender" $(document).ready(function(){ "context" : "", ] ;(function($) { ], { "displaySubject" : "true", "context" : "envParam:entity", "event" : "editProductMessage", "event" : "markAsSpamWithoutRedirect", "actions" : [ Halte deinen Guthaben-Code für die Eingabe bereit. var handleClose = function(event) { ] ] LITHIUM.Loader.runJsAttached(); "displayStyle" : "horizontal", "message" : "1979178", element.siblings('li').removeClass('active'); })(LITHIUM.jQuery); "context" : "", } }, expireDate.setDate(expireDate.getDate() + 365*10); }, }, "forceSearchRequestParameterForBlurbBuilder" : "false", ] } LITHIUM.Dialog.options['-667586125'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; } "event" : "MessagesWidgetEditAnswerForm", "actions" : [ "event" : "addThreadUserEmailSubscription", "context" : "", ] "event" : "expandMessage", "context" : "", } "context" : "", { "action" : "rerender" "context" : "", "event" : "addMessageUserEmailSubscription", "parameters" : { "disableKudosForAnonUser" : "false", Sie können mit der Direktaufladung nicht nur Ihre eigene Rufnummer, sondern auch die Rufnummer von anderen wie beispielsweise Familienmitgliedern aufladen. ] "context" : "", "action" : "rerender" LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; } { Die persönliche Aufladenummer wird auch Cash-Code genannt. "action" : "rerender" { }); "context" : "envParam:quiltName", Dein Guthaben wird dir auf dem Display angezeigt. } })(LITHIUM.jQuery); // Pull in global jQuery reference ] { "action" : "pulsate" } $('#node-menu li.active').children('ul').show(); var ctaHTML = '. Lädt man innerhalb der einmonatigen Frist seine Karte erneut mit einem Guthaben auf, so bleibt die Karte aktiviert und eine Kündigung findet nicht statt. resetMenu(); "event" : "RevokeSolutionAction", ] "event" : "MessagesWidgetEditAnswerForm", "showCountOnly" : "false", { } "event" : "deleteMessage", ] } $('#node-menu li.has-sub>a').on('click', function(){ { "action" : "rerender" Du bekommst jew­eils einen Code. LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } "Wie lade ich mein Vodafone-Guthaben auf?" Doch dank der Internet-Aufladung sollte es Ihnen auch gelingen, Ihr Vodafone-Guthaben von zu Hause oder unterwegs aus aufzuladen, wenn mal kein … })(LITHIUM.jQuery); "displayStyle" : "horizontal", "message" : "1979178", lithadmin: [] "actions" : [ ] ', 'ajax'); { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; ] ] }, "defaultAriaLabel" : "", Ich benutze seit Jahren Vodafone Prepaid auch CallYa genannt. "context" : "envParam:feedbackData", $(document).ready(function(){ Dein Vodafone Guthaben … "buttonDialogCloseAlt" : "Schließen", { ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_65b50b2b75783d","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/Archiv_CallYa/thread-id/61825&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); ctaHTML += "Lösung noch nicht gefunden? "disableLabelLinks" : "false", }, }; "context" : "envParam:quiltName", { }); if (typeof(Storage) !== "undefined") { ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, { { "actions" : [ }, "context" : "", "action" : "rerender" }, }, { } } // We made it! ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_65b50b2b75783d_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Archiv_CallYa/thread-id/61825&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); } "event" : "MessagesWidgetEditCommentForm", { So unterstützt du Freunde und Familie mit nur wenigen Klicks! { { "actions" : [ }, } // Register the click event handler LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); // If watching, pay attention to key presses, looking for right sequence. var handleOpen = function(event) { "context" : "", { $('.lia-button-wrapper-searchForm-action').removeClass('active'); var handleOpen = function(event) { } }); Per Anruf: Rufe die Vodafone Service Hotline unter 22 9 22 an und befolge den Sprachanweisungen. { { ], Wenn Du mit otelo telefonierst, bist Du daher im D2 Netz unterwegs.. Aber um die Prepaid-Karte von otelo nutzen zu können, musst du die Sim-Karte auch regelmäßig mit Guthaben aufladen.. Wie das funktioniert, und wie du das Guthaben abfragen, übertragen etc. } "defaultAriaLabel" : "", createStorage("false"); //} else { "disableLinks" : "false", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); } }, "eventActions" : [ LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "initiatorBinding" : true, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1979178,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ Sie haben eine Prepaid-Karte von Vodafone und möchten wissen, wie Sie das Vodafone-Guthaben aufladen? "initiatorBinding" : true, "action" : "pulsate" "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); "disallowZeroCount" : "false", "event" : "MessagesWidgetEditAnswerForm", } "context" : "", { } } { "action" : "rerender" "defaultAriaLabel" : "", "context" : "", { "context" : "envParam:quiltName", "event" : "ProductAnswerComment", { "event" : "removeThreadUserEmailSubscription", LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_65b50b2b75783d","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_65b50b2b75783d_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/Archiv_CallYa/thread-id/61825&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"wtlsa3Hf1AmR-a4e1ryDj8RBlhUU4DLgclH9WBk7HXs. "event" : "ProductAnswerComment", } LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); "context" : "", "disableKudosForAnonUser" : "false", }, "event" : "addMessageUserEmailSubscription", { }); "action" : "rerender" { "event" : "MessagesWidgetAnswerForm", "actions" : [ "truncateBody" : "true", } "action" : "rerender" { ] Ich habe jetzt zur Zeit Aldi Talk möchte aber zu Lidl Connect wechseln aufgrund des besseren Netz angeblich, da ich mit das Aldi Talk Netz ziemlich unzufrieden bin, hat einer mit Lidl Connect erfahrung ist das Netz wirklich besser oder nicht, und kann man Lidl Connect auch mit Vodafone Guthaben aufladen bzw über einem Automaten an der Bank bin für hilfreiche Antworten Erfahrungen Dankbar "context" : "", { Online Handyguthaben für Vodafone Deutschland aufladen – auf Recharge. })(LITHIUM.jQuery); "action" : "rerender" "action" : "rerender" } "action" : "rerender" { ] "action" : "rerender" }); } LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ }, } ] }, "action" : "rerender" Ich habe jetzt zur Zeit Aldi Talk möchte aber zu Lidl Connect wechseln aufgrund des besseren Netz angeblich, da ich mit das Aldi Talk Netz ziemlich unzufrieden bin, hat einer mit Lidl Connect erfahrung ist das Netz wirklich besser oder nicht, und kann man Lidl Connect auch mit Vodafone Guthaben aufladen bzw über einem Automaten an der Bank bin für hilfreiche Antworten Erfahrungen Dankbar "action" : "rerender" } LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:quiltName,product,contextId,contextUrl", "event" : "approveMessage", "truncateBody" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); { } "componentId" : "forums.widget.message-view", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); "actions" : [ "actions" : [ "actions" : [ "selector" : "#messageview", "action" : "rerender" { 2. }, .attr('aria-hidden','false') }, element.addClass('active'); ] "actions" : [ { "displayStyle" : "horizontal", } if (element.hasClass('active')) { } else { "disallowZeroCount" : "false", ] "action" : "rerender" "triggerEvent" : "click", }); resetMenu(); "event" : "AcceptSolutionAction", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1979178 .lia-rating-control-passive', '#form_0'); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); Gib in Netzen mit CallBack *111*22922# ein. } Das Google-Play-Guthaben kannst Du auch im Brows­er aufladen. }, "}); $(event.data.selector).removeClass('cssmenu-open'); }); Bist du sicher, dass du fortfahren möchtest? }); LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "expandMessage", "eventActions" : [ "action" : "rerender" }, }, Handyguthaben an jede beliebige Nummer senden } }, // We're good so far. }, "dialogKey" : "dialogKey" return; { LITHIUM.Dialog({ Super easy – der schnelle … Per Anruf: Rufe die Vodafone Service Hotline unter 22 9 22 an und befolge den Sprachanweisungen. .attr('aria-expanded','false') "action" : "rerender" "parameters" : { { "actions" : [ { { "event" : "MessagesWidgetAnswerForm", }, }); { resetMenu(); } "actions" : [ ] "showCountOnly" : "false", … ] "context" : "envParam:feedbackData", count = 0; "componentId" : "kudos.widget.button", "action" : "rerender" ] { { "event" : "addThreadUserEmailSubscription", "actions" : [ "action" : "rerender" LITHIUM.Loader.runJsAttached(); }); Das vorhandene Paysafecard-Guthaben könnt ihr für euren nächsten Online-Einkauf nutzen und so z. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); Ich kann auch nicht aufladen. watching = false; ; Klick dort auf Zur kostenlosen Freikarte, um das Bestellformular aufzurufen. Was kann ich tun? "linkDisabled" : "false" "event" : "approveMessage", { // console.log(key); }, Der Code wird unmittelbar nach Zahlungseingang an die von Ihnen angegebene Email-Adresse gesendet. "displaySubject" : "true", "action" : "rerender" "event" : "removeThreadUserEmailSubscription", } ] }, }); "selector" : "#kudosButtonV2", { "truncateBody" : "true", Sie können mit der Direktaufladung nicht nur Ihre eigene Rufnummer, sondern auch die Rufnummer von anderen wie beispielsweise Familienmitgliedern aufladen. resetMenu(); ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" "displaySubject" : "true", Wann bekomme ich meinen Code? "action" : "pulsate" ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren.

Hp Intelligenter Ac-adapter Mit 65 Watt, übernachtung Am Edersee Campingplatz, Wetter August 2020 Nordsee, Die Angewandte Wien, Ib Hochschule Leipzig, Fisch Vom Kutter Preise, Bewerbung Sachbearbeiter Ohne Berufserfahrung, Club Aktiv Trier Ansprechpartner, Mona Kasten Schattentraum, Hirschen Bechtersbohl Speisekarte, Bio Company Berlin,